Protein Info for EX28DRAFT_0401 in Enterobacter asburiae PDN3

Annotation: Outer membrane receptor for ferrienterochelin and colicins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07715: Plug" amino acids 43 to 151 (109 residues), 115.5 bits, see alignment E=2.5e-37 PF00593: TonB_dep_Rec" amino acids 229 to 629 (401 residues), 213.4 bits, see alignment E=1.7e-66 PF14905: OMP_b-brl_3" amino acids 392 to 642 (251 residues), 49.8 bits, see alignment E=4.5e-17

Best Hits

Swiss-Prot: 80% identical to CIRA_ECOLI: Colicin I receptor (cirA) from Escherichia coli (strain K12)

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 93% identity to enc:ECL_03465)

Predicted SEED Role

"Colicin I receptor precursor" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (656 amino acids)

>EX28DRAFT_0401 Outer membrane receptor for ferrienterochelin and colicins (Enterobacter asburiae PDN3)
MFRLNPFVRGGLCASAMSLALPVIAAESGDTMVVTASATEQNLKDAPASISVITQEDLQR
KPVQNLKDVLREVPGVQLTSEGDNRKGVSIRGLDSSYTLILIDGKRVNSRNAVFRHNDFD
LNWVPVDAIERIEVVRGPMSSLYGSDALGGVVNIITKKIGQKWTGTLSADSTVQEHRDRG
DTYNGQFYTSGPLVDGLLGVKAYGSLAKREKDGQQKSSTTASGETPRIEGFTSRDANVEF
AWTPSENHDFTAGYGFDRQDRDSDSLDKNRLERQNYSLSHNGRWGVGNSELKVYGEKVDN
KNPGNSNPITSESNAVDGKYVLPLGEINQLLTFGGEWRHDKLKDPVNLTGGSSSSTSTSQ
YALFLEDEWRLFEPLALTTGIRMDDHDTYGDHWSPRAYLVYNATDTVTVKGGWATAFKAP
SLLQLSPDWVTGSCRGACEIVGNPDLKPETSESFEFGLYYSGEEGWLEGVQASVTTFQNN
VDDRISISRTANAKQAQGYPNYVGLNADGEPIFRYYNVNKARIRGVETEVKFPVAEDWKV
TLNYTYNDGRDISNGGNKPLSDLPFHTANGTVDWKATQDWSFYVQGNYTGEKRALTSSAP
TPGGYVIWNTGAAWQVTKAVKLRAGVQNLLDKDLSRDDYSYTEDGRRYFVGVDYKF