Protein Info for EX28DRAFT_0394 in Enterobacter asburiae PDN3

Annotation: Phosphotransferase System HPr (HPr) Family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF00359: PTS_EIIA_2" amino acids 5 to 139 (135 residues), 104.9 bits, see alignment E=3.6e-34 TIGR01003: phosphocarrier, HPr family" amino acids 288 to 368 (81 residues), 72.7 bits, see alignment E=9.1e-25 PF00381: PTS-HPr" amino acids 288 to 369 (82 residues), 89.6 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 90% identical to PTFAH_ECOLI: Multiphosphoryl transfer protein (fruB) from Escherichia coli (strain K12)

KEGG orthology group: K02768, PTS system, fructose-specific IIA component [EC: 2.7.1.69] K11183, phosphocarrier protein FPr (inferred from 94% identity to enc:ECL_03473)

MetaCyc: 90% identical to fructose-specific PTS multiphosphoryl transfer protein FruB (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Fructose-specific phosphocarrier protein HPr (EC 2.7.1.69) / PTS system, fructose-specific IIA component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>EX28DRAFT_0394 Phosphotransferase System HPr (HPr) Family (Enterobacter asburiae PDN3)
MFQLSVQDIHPGAQAGDKEEAIRQVAAALVQAGNVADGYVNGMLAREQQTSTFLGNGIAI
PHGTADTRDQVLKTGVQVYQFPQGVLWGDGQVAYVAIGIAASSDEHLGLLRQLTHVLSDD
DVAEQLKSATTAEELRALLMGEKQSEALKLDNETLTLDVVASDLVTLQALNAGRLKEAGA
ADATFVTRVINDKPLNLGQGIWLNDSAEGNLRSAIAVSRAANPFDVEGERAAMLVTVAMN
DDQPVSVLKRLGDLLLNNKAEKLLNADASTVLALLTSDDAPTEDVQTAEFVVRNEHGLHA
RPGTMLVNTIKQFESEITVANLDGTGKPANGRSLMKVVALGVKKGHRLRFTAQGADAEQA
LKAIGDAIAAGLGEGA