Protein Info for EX28DRAFT_0385 in Enterobacter asburiae PDN3

Annotation: FOG: EAL domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 236 to 258 (23 residues), see Phobius details PF12792: CSS-motif" amino acids 44 to 234 (191 residues), 120.5 bits, see alignment E=6.6e-39 PF00563: EAL" amino acids 267 to 500 (234 residues), 212 bits, see alignment E=8.5e-67

Best Hits

Swiss-Prot: 63% identical to PDEN_ECOLI: Probable cyclic di-GMP phosphodiesterase PdeN (pdeN) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 89% identity to enc:ECL_03495)

Predicted SEED Role

"Rtn protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>EX28DRAFT_0385 FOG: EAL domain (Enterobacter asburiae PDN3)
MFTRYFSSNRKILILSIITGLIAALLLGSLQFFWSYHKREVKFDTLIHDVSIYMESYFDE
LKNSIDVLQPLTLNNCHDVNQELTSRAAFSVNVRAFLLVRDKMAFCSSATGPMNVPMEEL
IPELHIDKQIDMELLPGTPMLPNKPAIAIWYRNPLVKDGGVFTSVNLNLTPYLLYTARQD
EFAGIAIIIGDHALSTRSSTLVLAHDLHETPARTATLKDVPLTINLYADAWTSDEILYAL
FFGLVCGICAGSLNYYILSIRLNPGKEILSAIKRGQFYVVYQPVVDAKSLQMTGLEVLMR
WKHPTMGEIPPDAFINFAEAQKLIVPLTLHLFDLIIHDAPVLQTLLPPGAKVGINIAPGH
LHAESFKDDMRTFKALLPQDYFQIVLEITERDMLNHREANSLFEWLHNEGFEIAIDDFGT
GHSALIYLEHFTMDYLKIDRGFVNAIGTETVTSPVLDAVLTLARRLNMSTVAEGVETPEQ
AAWLREHGVNFLQGYWISRPMPLAQFREWRPDISPEGD