Protein Info for EX28DRAFT_0379 in Enterobacter asburiae PDN3

Annotation: drug resistance transporter, Bcr/CflA subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 135 to 160 (26 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 216 to 240 (25 residues), see Phobius details amino acids 252 to 272 (21 residues), see Phobius details amino acids 284 to 332 (49 residues), see Phobius details amino acids 344 to 366 (23 residues), see Phobius details amino acids 372 to 390 (19 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 6 to 390 (385 residues), 511.2 bits, see alignment E=2.5e-157 PF07690: MFS_1" amino acids 16 to 359 (344 residues), 173.8 bits, see alignment E=4.9e-55 PF00083: Sugar_tr" amino acids 49 to 188 (140 residues), 47.6 bits, see alignment E=1.2e-16 TIGR00880: multidrug resistance protein" amino acids 52 to 188 (137 residues), 136.9 bits, see alignment E=5.2e-44

Best Hits

Swiss-Prot: 89% identical to BCR_ECOLI: Bicyclomycin resistance protein (bcr) from Escherichia coli (strain K12)

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 97% identity to enc:ECL_03501)

MetaCyc: 89% identical to multidrug efflux pump Bcr (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-340; TRANS-RXN-44

Predicted SEED Role

"MFS family multidrug transport protein, bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>EX28DRAFT_0379 drug resistance transporter, Bcr/CflA subfamily (Enterobacter asburiae PDN3)
MTTRPHSSFKIVFILGLLAMLMPLSIDMYLPALPVISAQFGVPAGSAQMTLSTYILGFAL
GQLFYGPMADSLGRKPVILGGTLVFAAAAVACALAQTIDHLIVMRFFHGLAAAAASVVIN
ALMRDIYPKEEFSRMMSFVMLVTTIAPLVAPMAGGAVLVWFSWHVIFWILALAALLASAM
IFFFIDETLPVERRQKFHIRTTIGNFASLFRHKRVLSYMLASGFSFAGMFSFLSAGPFVY
IELNHVSPQHFGYYFALNIVFLFIMTIINSRFVRRVGALNMFRAGLWIQFVMAIWLVVSA
FLGVGFWALVVGVAAFVGCVSMVSSNAMAVILDEFPHMAGTASSLAGTFRFGIGAIVGAL
LSMATFMTAWPMLWAMAFCATSSILFYLYASRPRKAAH