Protein Info for EX28DRAFT_0375 in Enterobacter asburiae PDN3

Annotation: Nucleoid-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF04245: NA37" amino acids 10 to 324 (315 residues), 372.7 bits, see alignment E=9.5e-116

Best Hits

Swiss-Prot: 96% identical to NDPA_ENT38: Nucleoid-associated protein Ent638_2782 (Ent638_2782) from Enterobacter sp. (strain 638)

KEGG orthology group: K06899, nucleoid-associated protein (inferred from 99% identity to enc:ECL_03507)

Predicted SEED Role

"Nucleoid-associated protein NdpA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>EX28DRAFT_0375 Nucleoid-associated protein (Enterobacter asburiae PDN3)
MSLEINQIALHQLIKRDEQTLEVVLRDSLLEPTATVVEMMAELHRVYSAKNKAYGLFSEE
SELADSLRLQRQGEEDFLAFSRAATGRLRDELAKYPFADGGIVLFCHYRYLAVEYLLVTV
LNNLSSMRVNEQLDISSTHYLDINHADIVARIDLTEWETNPESTRYLTFLKGRVGRKVAD
FFMDFLGASEGLNAKAQNKGLLQAVDDFTAEAQLDKSERQTVRQQVYSYCNEQLQAGEEI
ELESLSKELAGVSEVSFQEFTAEKGYELEESFPADRSTLRQLTKFAGSGGGLTINFDAML
LGERIFWDPATDTLTIKGTPPNLRDQLQRRTSGGK