Protein Info for EX28DRAFT_0333 in Enterobacter asburiae PDN3

Annotation: proton-translocating NADH-quinone oxidoreductase, chain M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 509 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 78 to 103 (26 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 221 to 242 (22 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 341 to 363 (23 residues), see Phobius details amino acids 383 to 405 (23 residues), see Phobius details amino acids 417 to 440 (24 residues), see Phobius details amino acids 465 to 482 (18 residues), see Phobius details TIGR01972: proton-translocating NADH-quinone oxidoreductase, chain M" amino acids 3 to 499 (497 residues), 603.2 bits, see alignment E=1.7e-185 PF00361: Proton_antipo_M" amino acids 134 to 429 (296 residues), 233.1 bits, see alignment E=2.1e-73

Best Hits

Swiss-Prot: 95% identical to NUOM_ECOLI: NADH-quinone oxidoreductase subunit M (nuoM) from Escherichia coli (strain K12)

KEGG orthology group: K00342, NADH dehydrogenase I subunit M [EC: 1.6.5.3] (inferred from 100% identity to enc:ECL_03621)

MetaCyc: 95% identical to NADH:quinone oxidoreductase subunit M (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain M (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (509 amino acids)

>EX28DRAFT_0333 proton-translocating NADH-quinone oxidoreductase, chain M (Enterobacter asburiae PDN3)
MLLPWLILIPFIGGFLCWQTERFGVKMPRWIALITMGLTLALGLQLWLQGGYSLTQSAGI
PQWQSEFILPWIPRFGITIHLAIDGLSLLMVVLTGLLGVLAVLCSWREIEKYQGFFHLNL
MWILGGVIGVFLAIDMFLFFFFWEMMLVPMYFLIALWGHKASDGKTRITAATKFFIYTQA
SGLVMLIAILALVFVHHNATGTWTFNYEDLLKTPMSHGVEYLLMLGFFIAFAVKMPVVPL
HGWLPDAHSQAPTAGSVDLAGILLKTAAYGLLRFALPLFPNASAEFAPIAMWLGVIGIFY
GAWMAFTQYDIKRLIAYTSVSHMGFVLIAIYTGSQLAYQGAVIQMIAHGLSAAGLFILCG
QLYERLHTRDMRMMGGLWSKIKWLPALSMFFAVATLGMPGTGNFVGEFMILFGSFKVVPV
ITVISTFGLVFASVYSLAMLHRAYFGKAKSEIAAQELPGMSLRELFIILLLVVLLVLLGF
FPQPILDTSHSAMGNIQQWFVNSASTTRP