Protein Info for EX28DRAFT_0329 in Enterobacter asburiae PDN3

Annotation: NADH-quinone oxidoreductase, chain I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details TIGR01971: NADH-quinone oxidoreductase, chain I" amino acids 16 to 137 (122 residues), 168.4 bits, see alignment E=2.2e-54 PF13237: Fer4_10" amino acids 57 to 110 (54 residues), 31.5 bits, see alignment E=7.6e-11 PF00037: Fer4" amino acids 58 to 76 (19 residues), 21.9 bits, see alignment (E = 6.5e-08) amino acids 93 to 115 (23 residues), 35.1 bits, see alignment (E = 4.3e-12) PF12800: Fer4_4" amino acids 58 to 73 (16 residues), 16.2 bits, see alignment (E = 6e-06) amino acids 97 to 111 (15 residues), 15 bits, see alignment (E = 1.4e-05) PF13187: Fer4_9" amino acids 59 to 114 (56 residues), 30 bits, see alignment E=2.4e-10 PF12838: Fer4_7" amino acids 59 to 113 (55 residues), 43.3 bits, see alignment E=2.3e-14

Best Hits

Swiss-Prot: 99% identical to NUOI_SALCH: NADH-quinone oxidoreductase subunit I (nuoI) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 98% identity to ecl:EcolC_1371)

MetaCyc: 98% identical to NADH:quinone oxidoreductase subunit I (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (180 amino acids)

>EX28DRAFT_0329 NADH-quinone oxidoreductase, chain I (Enterobacter asburiae PDN3)
MTLKELLVGFGTQVRSIWMIGLHAFAKRETRMYPEEPVYLPPRYRGRIVLTRDPDGSERC
VACNLCAVACPVGCISLQKAETVDGRWYPEFFRINFSRCIFCGLCEEACPTTAIQLTPDF
ELGEYKRQDLVYEKEDLLISGPGKYPEYNFYRMAGMAIDGKDKGEAENEAKPIDVKSLLP