Protein Info for EX28DRAFT_0314 in Enterobacter asburiae PDN3

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 151 transmembrane" amino acids 46 to 65 (20 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details PF04217: DUF412" amino acids 11 to 149 (139 residues), 195.6 bits, see alignment E=1.9e-62

Best Hits

Swiss-Prot: 94% identical to YFBV_SALPA: UPF0208 membrane protein YfbV (yfbV) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K09899, hypothetical protein (inferred from 97% identity to enc:ECL_03639)

Predicted SEED Role

"FIG00731603: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (151 amino acids)

>EX28DRAFT_0314 Uncharacterized protein conserved in bacteria (Enterobacter asburiae PDN3)
MSTPENPSVNFFSLFRRGQHYAKTWPMEKRLAPMFIENRTIRATRYAIRFMPPVAVFTLC
WQIALGGQLGPAVATALFALSLPMQGLWWLGKRSITPLPPSILHWFYEVRGKLEEAGQAL
APVEGKPDYQALADTLKRAFKQLDKTFLDDL