Protein Info for EX28DRAFT_0274 in Enterobacter asburiae PDN3

Annotation: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR03533: protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific" amino acids 13 to 295 (283 residues), 461.4 bits, see alignment E=1.1e-142 TIGR00536: methyltransferase, HemK family" amino acids 15 to 303 (289 residues), 351.5 bits, see alignment E=2.8e-109 PF06325: PrmA" amino acids 132 to 207 (76 residues), 28.8 bits, see alignment E=2.2e-10 PF05175: MTS" amino acids 132 to 215 (84 residues), 56.3 bits, see alignment E=7.9e-19 PF13847: Methyltransf_31" amino acids 134 to 270 (137 residues), 29.4 bits, see alignment E=1.6e-10 PF09445: Methyltransf_15" amino acids 135 to 209 (75 residues), 28.3 bits, see alignment E=3.1e-10 PF13649: Methyltransf_25" amino acids 136 to 217 (82 residues), 34.9 bits, see alignment E=5.3e-12

Best Hits

Swiss-Prot: 93% identical to PRMB_SALTY: 50S ribosomal protein L3 glutamine methyltransferase (prmB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K07320, putative adenine-specific DNA-methyltransferase [EC: 2.1.1.72] (inferred from 99% identity to enc:ECL_03679)

MetaCyc: 93% identical to ribosomal protein L3 N5-glutamine methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-1241 [EC: 2.1.1.298]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmB, methylates LSU ribosomal protein L3p"

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.298 or 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>EX28DRAFT_0274 protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific (Enterobacter asburiae PDN3)
MDKIFVDEAVNELHTIQDMLRWSVSRFSAANIWYGHGTDNPWDEAVQLVLPSLYLPLDIP
EDMRTARLTSSEKHRIVERVIRRVNERIPVAYLTNKAWFCGHEFYVDERVLVPRSPIGEL
INNHFEGLIGHQPQHILDMCTGSGCIAIACAYAFPEAEVDAVDISTDALAVTEHNIEEHG
LIHHVTPIRSDLFRDLPTLQYDLIVTNPPYVDAEDMSDLPNEYRHEPELGLASGSDGLKL
TRRILACAPDYLTDDGVLICEVGNSMVHLIEQYPDVPFTWLEFDNGGDGVFMLTKVQLLD
AREHFSIYKD