Protein Info for EX28DRAFT_0266 in Enterobacter asburiae PDN3

Annotation: Formate/nitrite family of transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 61 to 83 (23 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 216 to 243 (28 residues), see Phobius details amino acids 256 to 280 (25 residues), see Phobius details PF01226: Form_Nir_trans" amino acids 43 to 280 (238 residues), 165.2 bits, see alignment E=8.9e-53

Best Hits

Swiss-Prot: 85% identical to YFDC_ECOLI: Inner membrane protein YfdC (yfdC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_03687)

Predicted SEED Role

"putative transport"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>EX28DRAFT_0266 Formate/nitrite family of transporters (Enterobacter asburiae PDN3)
MKDVGEEKIGESTEELEIESEEKARGEKIEIDEDRLPSRAMAIHEHIRQDGEKEMERDAM
ALFWSAIAAGLSMGASLLAKGIFHVQLEGLPGGFLLENLGYTFGFIIVIMARQQLFTENT
VTAVLPVMQNPTLGNFGLLMRLWSVVLLGNIIGTGIAAWAFEYMPIFDEPTRDAFVKIGM
DVMKNTPVEMFSNAIISGWIIATMVWMFPSAGSAKIVVIILMTWLIALADTTHIVVGTVE
ILYLVFNGTLHWSDFFWPFALPTLAGNICGGTFIFALLSHAQIRNDMSNKRKAELKAREN
DDKSTKKST