Protein Info for EX28DRAFT_0249 in Enterobacter asburiae PDN3

Annotation: Rhs element Vgr protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 790 TIGR03361: type VI secretion system Vgr family protein" amino acids 19 to 515 (497 residues), 237.6 bits, see alignment E=2.6e-74 TIGR01646: Rhs element Vgr protein" amino acids 26 to 517 (492 residues), 472.6 bits, see alignment E=1.7e-145 PF05954: Phage_GPD" amino acids 34 to 356 (323 residues), 180.3 bits, see alignment E=1e-56 PF04717: Phage_base_V" amino acids 407 to 474 (68 residues), 36.4 bits, see alignment E=1.1e-12 PF13296: T6SS_Vgr" amino acids 493 to 594 (102 residues), 110.9 bits, see alignment E=6.4e-36 PF10106: DUF2345" amino acids 613 to 755 (143 residues), 147.7 bits, see alignment E=5e-47

Best Hits

KEGG orthology group: None (inferred from 78% identity to pam:PANA_4144)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (790 amino acids)

>EX28DRAFT_0249 Rhs element Vgr protein (Enterobacter asburiae PDN3)
MSNNPPLRFSHNHHLLVVKGCEAELDVLAFEGDEALSRPFSYRVEFTSRDHGISKEMMLM
KPGSLTLQAPVDQGYGIKIQQPLRVIQGVVTGFERLGTSKDETHYALTLRPRLALLDRSH
QNAIYQDMSVPQIVEKILRERHGMRGQDFLFSLIKEYPRREQVMQYGEDDLHFITRLLGE
VGIWFRFTTDTRLNIDVVEFYDSQQGYEKGLTLPSVPPSGQHSQGVDSVWGMESHHSVVQ
KQVSTRDYNYRQATEDMNTLVDVTRGDATTYGEAYHYADNYLTPGSAYDLNPAPESGAFY
ARIRHERYLNGQTQTRAITSSPALSPGMLLKVTGGYEVADVFAQGVVITAMQTHARRDED
FSLRFDGIPDSPDFSFRPEPGSRPVMAGTLPARVTSTTENDTYGHIDKDGRYRVSMLFDR
DSWETGFESLWVRQSRPYAGDTYGLHLPLLAGTEVAIGFEDGNPDRPYISGVLHDSAHGD
HVTIQNYKRNVLRTPANNKIRLDDERGKEHIKVSTEYGGKSQLNLGHLVDSEKQQRGEGF
ELRTDSWGAIRAQKGLFISADGQTKAQGLQREMQAALKELDAAREVTSGLRHAAQAAQAE
LADLEKQTALMNQTLSDLKQQALLLSAPSGIAQVTPASVQVSAGENLIVTAGQNADISIA
KKFTLAVGDILSLFAHKLGIKMYASEGKVDIQAQSDALNLFAKENLSVASSDNSVVISAK
KEIFLVCGGSFIRLSDAGVEVGTGKNVTLKCIAVQQQSAATLNSTLSLPSGCKAGIISAA
QQQGAVVMLS