Protein Info for EX28DRAFT_0245 in Enterobacter asburiae PDN3

Annotation: type IV / VI secretion system protein, DotU family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 229 transmembrane" amino acids 190 to 212 (23 residues), see Phobius details TIGR03349: type IV/VI secretion system protein, DotU family" amino acids 14 to 218 (205 residues), 105.7 bits, see alignment E=1.5e-34 PF09850: DotU" amino acids 15 to 213 (199 residues), 90.8 bits, see alignment E=5e-30

Best Hits

KEGG orthology group: K11892, type VI secretion system protein ImpK (inferred from 88% identity to enc:ECL_01804)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (229 amino acids)

>EX28DRAFT_0245 type IV / VI secretion system protein, DotU family (Enterobacter asburiae PDN3)
MSERKHGAAVSVDIDALLQNTWLQVISLRHGPQFQEGEGRVLWERCVADVERVQRELKAS
ELDEASCEHILTAQCALLDEAVKGRGVEDDACVQWYDIPLQGHFLGTMDAGDTLCDRMRD
VLREPAPDNAVLTCFQRVMMLGFMGSFRSLNDPERQKLVSALSEHVAPFSFPQTHPVLAE
SRAGWGMGGWLASWPARIGLSVIVLAALWWGLDRWLDQMLLTLLPGAIK