Protein Info for EX28DRAFT_0241 in Enterobacter asburiae PDN3

Annotation: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 125 to 143 (19 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 5 to 295 (291 residues), 362.2 bits, see alignment E=1e-112 TIGR02207: lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase" amino acids 5 to 304 (300 residues), 451.2 bits, see alignment E=8.8e-140

Best Hits

Swiss-Prot: 84% identical to LPXP_ECOLI: Lipid A biosynthesis palmitoleoyltransferase (lpxP) from Escherichia coli (strain K12)

KEGG orthology group: K12974, palmitoleoyl transferase [EC: 2.3.1.-] (inferred from 94% identity to enc:ECL_03721)

MetaCyc: 84% identical to palmitoleoyl acyltransferase (Escherichia coli K-12 substr. MG1655)
PALMITOTRANS-RXN [EC: 2.3.1.242]

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.242

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>EX28DRAFT_0241 lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase (Enterobacter asburiae PDN3)
MSQSKFQRAFLHPRYWFTWFGLGVLWLLVQLPYPVLRLLGSKLGSASRVFLKRRESIARK
NIELCFPQYNAEEREKLIAENFKSIGMALLETGMAWFWPDERVRKWFDVEGLDNLKRAQM
QKRGVMVVGVHFMSLELGGRVMGLCQPMMATYRPHNSALMEWVQTRGRMRSNKAMISRNN
LRGMVGALKKGEAVWFAPDQDYGRKGSSFAPFFAVKDVATTNGTFVISRLSGASMLTVTM
VRKADKSGYRLHISPEMANYPENECEAAAFINKVIETEIMRAPEQYLWMHRRFKTRPLGE
TSLYI