Protein Info for EX28DRAFT_0206 in Enterobacter asburiae PDN3

Annotation: sulfate ABC transporter, permease protein CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 signal peptide" amino acids 12 to 12 (1 residues), see Phobius details transmembrane" amino acids 13 to 39 (27 residues), see Phobius details amino acids 60 to 85 (26 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 196 to 224 (29 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 7 to 269 (263 residues), 379 bits, see alignment E=1.4e-117 TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 9 to 271 (263 residues), 375.8 bits, see alignment E=1.3e-116 PF00528: BPD_transp_1" amino acids 76 to 274 (199 residues), 97.5 bits, see alignment E=4.1e-32

Best Hits

Swiss-Prot: 97% identical to CYST_ECOLI: Sulfate transport system permease protein CysT (cysU) from Escherichia coli (strain K12)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 97% identity to eco:b2424)

MetaCyc: 97% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>EX28DRAFT_0206 sulfate ABC transporter, permease protein CysT (Enterobacter asburiae PDN3)
MFAVSTKRVLPGFTLSLGTSLLFVCLILLLPLSALVMQLAQMSWAQYWDVVTNPQVVAAY
KVTLLSAFVASIFNGVFGLLMAWILTRYRFPGRTLLDALMDLPFALPTAVAGLTLASLFS
VNGLYGEWLAKFDIKVTYTWLGIAVAMAFTSIPFVVRTVQPVLEELGPEYEEAAETLGAT
RWQSFRKVVLPELSPALMAGVALSFTRSLGEFGAVIFIAGNIAWKTEVTSLMIFIRLQEF
DYPAASAIASVILAASLLLLYSINTLQSRFGRRVVGH