Protein Info for EX28DRAFT_0202 in Enterobacter asburiae PDN3

Annotation: Protein of unknown function (DUF2919)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 149 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details PF11143: DUF2919" amino acids 7 to 145 (139 residues), 155.4 bits, see alignment E=6.8e-50

Best Hits

Swiss-Prot: 76% identical to YFEZ_ECOLI: Inner membrane protein YfeZ (yfeZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to enc:ECL_03756)

Predicted SEED Role

"Inner membrane protein YfeZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (149 amino acids)

>EX28DRAFT_0202 Protein of unknown function (DUF2919) (Enterobacter asburiae PDN3)
MKSTEIHPADYDAQGRVRLPFLFWCVLLLQARTWVLFVMAGASRGQGDTLLNLFYPDHDA
FWIGLLPGIPAVLAFLVSGRRHLIPRFWRALRWLLILAQVALLFWQPVLWWYGEPLTGTG
VALVVADIVALLWLLTNPRLRACFAHQDD