Protein Info for EX28DRAFT_0193 in Enterobacter asburiae PDN3

Annotation: glutamate synthase small subunit family protein, proteobacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13247: Fer4_11
  • amino acids 53 to 144 (92 residues), 37.9 bits, E=1.4e-12
• PF00037: Fer4
  • amino acids 80 to 101 (22 residues), 28.6 bits, see alignment (E = 7.1e-10)
• PF12837: Fer4_6
  • amino acids 80 to 100 (21 residues), 27.9 bits, see alignment (E = 1.3e-09)
• PF12797: Fer4_2
  • amino acids 81 to 99 (19 residues), 25.6 bits, see alignment (E = 6.7e-09)
• TIGR01318: glutamate synthase, small subunit
  • amino acids 186 to 651 (466 residues), 824.9 bits, E=8e-253
• PF14691: Fer4_20
  • amino acids 204 to 314 (111 residues), 123.7 bits, E=2.6e-39
• PF07992: Pyr_redox_2
  • amino acids 328 to 639 (312 residues), 91.2 bits, E=6.8e-29
• PF00070: Pyr_redox
  • amino acids 328 to 362 (35 residues), 24.4 bits, see alignment (E = 2.8e-08)
  • amino acids 469 to 544 (76 residues), 23.6 bits, E=4.7e-08
• PF01494: FAD_binding_3
  • amino acids 329 to 359 (31 residues), 27.9 bits, see alignment (E = 1.2e-09)
• PF12831: FAD_oxidored
  • amino acids 329 to 369 (41 residues), 27.8 bits, 1.3e-09
• PF13450: NAD_binding_8
  • amino acids 331 to 365 (35 residues), 37.9 bits, see alignment (E = 1.5e-12)

Best Hits

Swiss-Prot: 78% identical to AEGA_ECOLI: Protein AegA (aegA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to enc:ECL_03765)

Predicted SEED Role

"Glutamate synthase [NADPH] small chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Protein Sequence (658 amino acids)

>EX28DRAFT_0193 glutamate synthase small subunit family protein, proteobacterial (Enterobacter asburiae PDN3)
MNRFIMANSQQCIGCRACEVACVMAHNDEQHVLSERHFHPRITVLRAGEKSSPVTCHHCE
NAPCAQSCPNGAISKCDDSVQVNQQKCIGCKACVVACPFGTMEIIVTPLDNGSVKASANK
CDLCLTRPHGPACIENCPADVLSLATPAVLDTLAKSRRQRTACLEAQPWHAEVVGEAAPR
TKLQQMQATAPRGEPDKLAAAERVSHFNEIYLPFRAGQAAREASRCLKCGEHSICEWTCP
LHNHIPQWIERLNAGDITGAVELSHQTNCLPEITGRVCPQDRLCEGACTIREEAGSVTIG
NIERYISDRALAMGWRPDMSAVTPTGKRVAIVGAGPAGLACADVLARSGVSVTVYDRHPE
IGGLLTFGIPAFKLDKSLLARRREIFTAMGIRFELNCEVGQDVSMSQLKHDYDALFIGVG
TYRSMKAGIPHEDAPGVYDALPFLVGNTRHVMGLETTASEPFIDTHGLNVVVLGGGDTAM
DCVRTALRHGAAEVTCAYRRDEANMPGSKKEVKNAREEGAAFEFNVQPVELTLDPDGKVN
GIRMLRTELGEPDAQGRRRPVPVAGSEFVMAADAVIMAFGFNPHAMPWLQAQGVETDDRG
RIVASVESRYRYQTTNPQIFAGGDAVRGADLVVTAMAEGRHAAQGILDWLGINAPKHH