Protein Info for EX28DRAFT_0186 in Enterobacter asburiae PDN3

Annotation: Predicted P-loop ATPase fused to an acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 PF05127: Helicase_RecD" amino acids 187 to 327 (141 residues), 135.1 bits, see alignment E=6.2e-43 PF13718: GNAT_acetyltr_2" amino acids 360 to 466 (107 residues), 45 bits, see alignment E=2.2e-15 amino acids 474 to 516 (43 residues), 26.4 bits, see alignment 1.1e-09 PF17176: tRNA_bind_3" amino acids 523 to 630 (108 residues), 103.9 bits, see alignment E=1.8e-33

Best Hits

Swiss-Prot: 61% identical to TMCA_CITK8: tRNA(Met) cytidine acetyltransferase TmcA (tmcA) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K06957, tRNA(Met) cytidine acetyltransferase [EC: 2.3.1.-] (inferred from 79% identity to enc:ECL_03772)

MetaCyc: 60% identical to tRNAMet cytidine acetyltransferase (Escherichia coli K-12 substr. MG1655)
RXN0-5418 [EC: 2.3.1.193]

Predicted SEED Role

"Predicted P-loop ATPase fused to an acetyltransferase COG1444"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.- or 2.3.1.193

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (648 amino acids)

>EX28DRAFT_0186 Predicted P-loop ATPase fused to an acetyltransferase (Enterobacter asburiae PDN3)
MLEFEQLIGELERTGHRRLVVLSGEAQWTLSKAVTLRDALPGDWVRLDEHPSKAISGLLG
REFRHAVFDASAGFDVAAFAALSGTLSAGSLLVLRVPPLDAWSGLPDSDSLRWSDGAEAI
ATPHFVHHFCRTIDADPDAIVWHQGRALSLPPIPDAPDWQPASGAPQREQAEILDVLQGM
AEGIVAVTAARGRGKSALAGMLLNRIAGSAVVTAPSKGATDIIARFAGEHFHFMAPDALL
ASSHRADWLIVDEAAAIPGPLLEKLAVRFPRVLLTTTVQGYEGTGRGFLLKFCGRFAGLQ
RYSLSTPVRWSAGCPLERVVASALLFDDTLIDRRPEGEVRLTSLTPEAWERRPALAASVY
ELLCAAHYRTSPLDLRRMMDAPGQRFAVAETDPDIAGALWLVEEGGLSPELSRAVWAGYR
RPRGNLVAQSLAAHGGSPLAATLRGRRVTRIAVHPHRQREGIGQALVRSASGEDYLSVSF
GYTDELWRFWQQCGFVLVRMGSHREASSGCYTAMALLPQSQAGRQLCEQAQRRLKRDARV
LSAWNGEKIPVEDGWEATLNHDDWLELAGFAFAHRAFSTSVAALTRLLLTVDMPLPALRG
KMAGKTEDVGRKALLATLRSETAQAIESLDYPRCQQLKEDILQWQFFQ