Protein Info for EX28DRAFT_0185 in Enterobacter asburiae PDN3

Annotation: Predicted metalloprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 37 to 59 (23 residues), see Phobius details PF04228: Zn_peptidase" amino acids 1 to 285 (285 residues), 487.8 bits, see alignment E=6.5e-151

Best Hits

Swiss-Prot: 92% identical to YPFJ_ECO57: Uncharacterized protein YpfJ (ypfJ) from Escherichia coli O157:H7

KEGG orthology group: K07054, (no description) (inferred from 95% identity to enc:ECL_03773)

Predicted SEED Role

"YpfJ protein, zinc metalloprotease superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>EX28DRAFT_0185 Predicted metalloprotease (Enterobacter asburiae PDN3)
MRWQGRRESDNVEDRRSDGGGGPSMGGPGFRLPSGKGGIILLIVVLVAGYYGVDLTGLMT
GQPLQQQEHSQRSISPNEDEAAKFTSVILATTEDTWSQLFEKMGRTYQQPKLVMYRGATR
TGCGTGQSVMGPFYCPADGTVYIDLSFYDDMKRKLGADGDFAQGYVIAHEVGHHVQKLLG
IEPKVRQLQQNASQAEVNRLSVKMELQADCFAGVWGHSMQQQGVLESGDLEEALNAAQAI
GDDRLQQQSQGRVVPDSFTHGTSQQRYSWFKRGFDSGDPAQCNTFGKAM