Protein Info for EX28DRAFT_0178 in Enterobacter asburiae PDN3

Annotation: Putative Zn-dependent protease, contains TPR repeats

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF01435: Peptidase_M48" amino acids 75 to 259 (185 residues), 105.7 bits, see alignment E=4.1e-34 PF14559: TPR_19" amino acids 354 to 418 (65 residues), 39.2 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 90% identical to BEPA_ECO57: Beta-barrel assembly-enhancing protease (bepA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 98% identity to enc:ECL_03780)

MetaCyc: 90% identical to beta-barrel assembly-enhancing protease (Escherichia coli K-12 substr. MG1655)
Peptidase Do. [EC: 3.4.21.107]

Predicted SEED Role

"Exported zinc metalloprotease YfgC precursor"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.107

Use Curated BLAST to search for 3.4.21.107

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (487 amino acids)

>EX28DRAFT_0178 Putative Zn-dependent protease, contains TPR repeats (Enterobacter asburiae PDN3)
MFRQLRKTLVATLIAAVTVGQVLPAFADSSDSLPDMGTTAGSTLSIGQEMQMGDYYVRQL
RGSAPLINDPLLVQYINGLGMRLVSHADSVKTPFHFYLINNDEINAFAFFGGNVVLHSAL
FRYSDNESQLASVMAHEISHVTQRHLARAMEDQKRNAPLTWVGALGSILLAMASPQAGMA
ALTGTLAGTRQGMISFTQQNEQEADRIGIQVLQRSGFDPQAMPSFLEKLLDQARYSSRPP
EILLTHPLPESRLSDARNRANQMRPVVVQSSQDFYMAKVRTLGMYNSGRNQLTSDLLDSL
AKGNVREKNAAQYGQALQAMEASKYDEARKALQPLLAADPNNPWYLDLSTDIDLGQKKTA
DAINRLKGAKDVRTNPVLQLNLANAYLQGGQPGEAATILNRYTFNNKDDQNGWDLLAQAE
AQLGNRDQELAARAEGFALVGRLDQAISTLSSASSQVKLGSLQQARYDARIDQLRALQQR
FKPYEKM