Protein Info for EX28DRAFT_0153 in Enterobacter asburiae PDN3

Annotation: Predicted dehydrogenases and related proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF01408: GFO_IDH_MocA" amino acids 4 to 130 (127 residues), 91.1 bits, see alignment E=1.8e-29 PF03447: NAD_binding_3" amino acids 40 to 128 (89 residues), 25.7 bits, see alignment E=3.3e-09 PF22725: GFO_IDH_MocA_C3" amino acids 139 to 274 (136 residues), 100.7 bits, see alignment E=1.2e-32 PF02894: GFO_IDH_MocA_C" amino acids 142 to 373 (232 residues), 79.9 bits, see alignment E=4.9e-26

Best Hits

KEGG orthology group: None (inferred from 98% identity to enc:ECL_03803)

MetaCyc: 45% identical to levoglucosan dehydrogenase monomer (Pseudarthrobacter phenanthrenivorans)
RXN-20952 [EC: 1.1.1.425]

Predicted SEED Role

"Myo-inositol 2-dehydrogenase 2 (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18 or 1.1.1.425

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>EX28DRAFT_0153 Predicted dehydrogenases and related proteins (Enterobacter asburiae PDN3)
MKEVRIGLIGTGYIGKAHAIAYAQAPTVFNLRGRLVREMVAEVTPELAAERAQAFGFNRS
TGDWRALVADPAIDVVDICSPNHLHKEMALEAIRHGKHVYSEKPLALNAHDAREMVDAAK
RAGVKTLVGFNYMKNPTAQLAKEIIARGEIGEVIHFYGTHNEDYMADPLSPIHWHCFKET
AGLGALGDLAAHIVNMAQYLVGEIEQVCGDLKIVVPERPAKAGSSEMIAVENEDQAHAMV
RFAGGAQGVIETSRVACGRKMGLSYVITGTKGAISFTQERMAELKLYLHDDPVNRQGFRT
LLVGPAHPDYAAFCMGAGHGIGFNDQKTVEVRDLVDGIAADAPMWPDFEEGWKVSRVLDA
IALSHREGRWLNVNDIV