Protein Info for EX28DRAFT_0148 in Enterobacter asburiae PDN3

Annotation: Acetolactate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR04377: 3,5/4-trihydroxycyclohexa-1,2-dione hydrolase
  • amino acids 5 to 639 (635 residues), 928.2 bits, E=1.3e-283
• PF02776: TPP_enzyme_N
  • amino acids 6 to 134 (129 residues), 57 bits, E=2.6e-19
• PF00205: TPP_enzyme_M
  • amino acids 220 to 353 (134 residues), 109.4 bits, E=1.7e-35
• PF02775: TPP_enzyme_C
  • amino acids 437 to 596 (160 residues), 129.6 bits, E=1.3e-41

Best Hits

Swiss-Prot: 62% identical to IOLD_GEOTN: 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase (iolD) from Geobacillus thermodenitrificans (strain NG80-2)

KEGG orthology group: K03336, 3D-(3,5/4)-trihydroxycyclohexane-1,2-dione hydrolase [EC: 3.7.1.-] (inferred from 94% identity to enc:ECL_03808)

Predicted SEED Role

"Epi-inositol hydrolase (EC 3.7.1.-)" in subsystem Inositol catabolism (EC 3.7.1.-)

MetaCyc Pathways

• myo-inositol degradation I (7/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (7/10 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Caprolactam degradation
• Ethylbenzene degradation
• Inositol phosphate metabolism
• Limonene and pinene degradation
• Nicotinate and nicotinamide metabolism
• Phenylalanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.7.1.-

Use Curated BLAST to search for 3.7.1.-

Protein Sequence (641 amino acids)

>EX28DRAFT_0148 Acetolactate synthase (Enterobacter asburiae PDN3)
MQTERMTMAQALVRFLNQQYVSVDGNETPFVEGVATIFGHGNVLGIGQALEQDPGHLQVM
QGCNEQGIAHMATGFSKQHRRQRIFAVTSSVGPGAANMVTAAATATANRIPLLLLPGDIY
ASRQPDPVLQQIEQYHDLSISTNDCFRPVSRYWDRINRPEQLMSAMLSAMRTLTDPANTG
AVTICLPQDVQGEAWDYPLSFFARRVHHIERRPPDPQRLAQARALIARKRRPLVVCGGGV
RYSGAHEAFREFVETLRLPFAETQAGKGALVSDHPFNLGGVGVTGGMAANQLAPQADLVI
GIGTRLTDFTTGSKALFSHPDVEFLLLNVAEFDALKLDATALIADAQTGLQALTHALGDY
RSGWGEAIAEAKSAWRDECRRLWDRQWCPDDAPEVAGHLDAQLAEYGETLSTRLTQTRVL
GLINQLIEDNAIVVGAAGSLPGDLQRLWQVKTPDSYHLEYGYSCMGYEIAAALGAKLARP
ELPVYAMVGDGSYMMLHSELQTAVQEGIKIAVLLFDNASFGCINNLQMGHGMGSFGTENR
RRNPETGRLDGPLVKVDFAQNAESYGCRAWRVNDEQSLLAALEASRAHPGPTLLDIKVLP
KTMTHDYASWWRTGDAQVAESSAVREAAEQTQAQVKKARQY