Protein Info for EX28DRAFT_0140 in Enterobacter asburiae PDN3

Annotation: GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit/GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain" amino acids 10 to 205 (196 residues), 280.1 bits, see alignment E=6.5e-88 PF00117: GATase" amino acids 11 to 199 (189 residues), 157.3 bits, see alignment E=9.7e-50 PF07722: Peptidase_C26" amino acids 75 to 183 (109 residues), 33.5 bits, see alignment E=9.3e-12 TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain" amino acids 212 to 525 (314 residues), 517.2 bits, see alignment E=1.5e-159 PF02540: NAD_synthase" amino acids 217 to 256 (40 residues), 29 bits, see alignment 1.5e-10 PF03054: tRNA_Me_trans" amino acids 229 to 262 (34 residues), 23 bits, see alignment (E = 1.4e-08) PF00958: GMP_synt_C" amino acids 433 to 524 (92 residues), 147.3 bits, see alignment E=2.9e-47

Best Hits

Swiss-Prot: 99% identical to GUAA_KLEP3: GMP synthase [glutamine-hydrolyzing] (guaA) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 99% identity to enc:ECL_03844)

MetaCyc: 97% identical to GMP synthetase (Escherichia coli K-12 substr. MG1655)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]; 6.3.5.2 [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (525 amino acids)

>EX28DRAFT_0140 GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit/GMP synthase (glutamine-hydrolyzing), N-terminal domain or A subunit (Enterobacter asburiae PDN3)
MTENIHKHRILILDFGSQYTQLVARRVRELGVYCELWAWDVTEAQIREFNPSGIILSGGP
ESTTEENSPRAPQYVFEAGVPVFGVCYGMQTMAMQLGGHVEGSNEREFGYAQVEVVTDSA
LVRGIEDSLTADGKPLLDVWMSHGDKVTAIPSDFVTVASTESCPFAIMANEEKRFYGVQF
HPEVTHTRQGMRMLERFVRDICQCEALWTPAKIIDDAVERIRQQVGDDKVILGLSGGVDS
SVTAMLLHRAIGKNLTCVFVDNGLLRLNEAQQVMDMFGDHFGLNIVHVEGEQRFLDALKG
ENDPEAKRKIIGRVFVEVFDEEALKLEDVKWLAQGTIYPDVIESAASATGKAHVIKSHHN
VGGLPKEMKMGLVEPLRELFKDEVRKIGLELGLPYDMLYRHPFPGPGLGVRVLGEVKKEY
CDLLRRADAIFIEELHKADLYNKVSQAFTVFLPVRSVGVMGDGRKYDWVVSLRAVETIDF
MTAHWAHLPYDFLGRVSNRIINEVNGISRVVYDISGKPPATIEWE