Protein Info for EX28DRAFT_0087 in Enterobacter asburiae PDN3

Annotation: Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 115 to 139 (25 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 181 to 202 (22 residues), see Phobius details amino acids 214 to 231 (18 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details amino acids 426 to 447 (22 residues), see Phobius details PF00367: PTS_EIIB" amino acids 10 to 42 (33 residues), 43.8 bits, see alignment (E = 1.4e-15) PF02378: PTS_EIIC" amino acids 117 to 391 (275 residues), 130.9 bits, see alignment E=5.9e-42

Best Hits

KEGG orthology group: K02809, PTS system, sucrose-specific IIB component [EC: 2.7.1.69] K02810, PTS system, sucrose-specific IIC component (inferred from 95% identity to enc:ECL_03898)

Predicted SEED Role

"PTS system, N-acetylmuramic acid-specific IIB component (EC 2.7.1.69) / PTS system, N-acetylmuramic acid-specific IIC component" in subsystem Sialic Acid Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>EX28DRAFT_0087 Phosphotransferase system IIC components, glucose/maltose/N-acetylglucosamine-specific (Enterobacter asburiae PDN3)
MDKTAALASDILQGIGGEKNIQRLENCMTRVRVEVHNDDQLDVPRLKQLSGVSGYVKQGQ
QHQLIVGPGKAAQVVDAMRALMGVSASASMDDAERTKAQAKAKYKAPMSDALRQLANVFI
PLIPAFIASGLITGIINILKRPDIVGDFATQYPNLLGILGIFGSAVFAIMNILVGVNTAK
VFGGSLAMGGVMAGILSSPQLAQITLFGEALQPGRGGVIAVLLVVILMCWIEKRLRAILP
GSIELILNPLLTTLITGSVAIVALQPLGGWISEAIAHGASLAIDRGGLLVGAVLSGTFLP
LVLTGLHQGLVPIHVELVQSHGYNALLPILSMAGVGQVGAAIAVLMKTRNARLKKMIKGA
LPVGLLGIGEPLIFGVTLPLGKPFLAACLGGAVGGALISYWKVATVITFGLSGLPLALTI
VTGKVMLYLLGYLVAVIAGFLFTWLLGFNDPEE