Protein Info for EX28DRAFT_0070 in Enterobacter asburiae PDN3

Annotation: Predicted O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details PF01596: Methyltransf_3" amino acids 61 to 147 (87 residues), 24.2 bits, see alignment E=5.8e-09 PF01135: PCMT" amino acids 84 to 160 (77 residues), 22 bits, see alignment E=3.8e-08 PF06325: PrmA" amino acids 86 to 162 (77 residues), 25.1 bits, see alignment E=3.5e-09 PF05175: MTS" amino acids 86 to 168 (83 residues), 45.7 bits, see alignment E=1.6e-15 PF13649: Methyltransf_25" amino acids 88 to 161 (74 residues), 34.6 bits, see alignment E=7.9e-12 PF01170: UPF0020" amino acids 104 to 210 (107 residues), 25.8 bits, see alignment E=2.4e-09

Best Hits

Swiss-Prot: 87% identical to TRMN6_ENT38: tRNA1(Val) (adenine(37)-N6)-methyltransferase (Ent638_3062) from Enterobacter sp. (strain 638)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_03913)

MetaCyc: 72% identical to tRNA m6A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12480 [EC: 2.1.1.223]

Predicted SEED Role

"tRNA (adenine37-N(6))-methyltransferase TrmN6 (EC 2.1.1.223)" (EC 2.1.1.223)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>EX28DRAFT_0070 Predicted O-methyltransferase (Enterobacter asburiae PDN3)
MWGADYRRYGCNLHLFVWISLFGHFAFPYATPFHLEGCPDMSQLKAQLRRDGFTFKQFFV
AHDRCAMKVGTDGILLGAWAPVAGVKRILDIGTGSGLVALMLAQRTEEHVIIDAVELDAQ
AAEQASDNMAESPWAARMKVECADVLAWAPEQTARYDLIVSNPPYYEPGVECGTPEREQA
RYTGSLDHKALLTSAAELISEEGFFCVVLPESTGNTFISIALEIGWTLRLRTDISDTEGR
LPHRVLLVLSPKEGECFNDRMVIRGPDQRYSEDYTALTQAFYLFM