Protein Info for EX28DRAFT_0068 in Enterobacter asburiae PDN3

Annotation: autonomous glycyl radical cofactor GrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 TIGR04365: autonomous glycyl radical cofactor GrcA" amino acids 2 to 127 (126 residues), 229.7 bits, see alignment E=4.4e-73 PF01228: Gly_radical" amino acids 16 to 108 (93 residues), 67.4 bits, see alignment E=7.6e-23

Best Hits

Swiss-Prot: 94% identical to GRCA_SALPA: Autonomous glycyl radical cofactor (grcA) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K06866, autonomous glycyl radical cofactor (inferred from 98% identity to enc:ECL_03915)

MetaCyc: 92% identical to stress-induced alternate pyruvate formate-lyase subunit (Escherichia coli K-12 substr. MG1655)
Formate C-acetyltransferase. [EC: 2.3.1.54]; 2.3.1.54 [EC: 2.3.1.54]

Predicted SEED Role

"Pyruvate formate-lyase (EC 2.3.1.54)" in subsystem Butanol Biosynthesis or Fermentations: Mixed acid (EC 2.3.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.54

Use Curated BLAST to search for 2.3.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (127 amino acids)

>EX28DRAFT_0068 autonomous glycyl radical cofactor GrcA (Enterobacter asburiae PDN3)
MITGIQITKAANDDLLNSFWLLDSEKNEARCVVAKAGFAEDEIVPVSKLGEIEYREIPME
VKPEVRVEGGQHLNVNVLRRETLMDAVEHPEKYPQLTIRVSGYAVRFNSLTPEQQRDVIA
RTFTESL