Protein Info for EX28DRAFT_0064 in Enterobacter asburiae PDN3

Annotation: Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF03942: DTW" amino acids 29 to 214 (186 residues), 190.3 bits, see alignment E=1.6e-60

Best Hits

Swiss-Prot: 80% identical to YFIP_ECOLI: DTW domain-containing protein YfiP (yfiP) from Escherichia coli (strain K12)

KEGG orthology group: K05812, conserved hypothetical protein (inferred from 94% identity to enc:ECL_03919)

MetaCyc: 80% identical to tRNA 3-amino-3-carboxypropyltransferase (Escherichia coli K-12 substr. MG1655)
tRNA-uridine aminocarboxypropyltransferase. [EC: 2.5.1.25]

Predicted SEED Role

"FIG00626140: hypothetical protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>EX28DRAFT_0064 Uncharacterized conserved protein (Enterobacter asburiae PDN3)
MTDNAVLKLRAERLARATRPFLARGNRIRRCQRCLLPLKVCLCETLAPSTAESRFCLVMF
DTEPMKPSNTGRLIADILPDTAAFQWSRTEPPQALLDLVASPDYQPMVVFPASYAGAERQ
VLSTPPSGKPPLFIMLDGTWTEARKMFRKSPYLDALPVISVDLSRVSAYRLREAHADGQY
CTAEVAIALLDLAGDTAAAGALGNHFSCFRERYLAGKTVHKGSVTAPEPESV