Protein Info for EX28DRAFT_0037 in Enterobacter asburiae PDN3

Annotation: large conductance mechanosensitive channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01741: MscL
  • amino acids 3 to 130 (128 residues), 161.2 bits, E=7.2e-52
• TIGR00220: large conductance mechanosensitive channel protein
  • amino acids 3 to 132 (130 residues), 198.8 bits, E=1.6e-63

Best Hits

Swiss-Prot: 96% identical to MSCL_CITK8: Large-conductance mechanosensitive channel (mscL) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 97% identity to enc:ECL_04667)

MetaCyc: 95% identical to large conductance mechanosensitive channel (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-86

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Protein Sequence (136 amino acids)

>EX28DRAFT_0037 large conductance mechanosensitive channel protein (Enterobacter asburiae PDN3)
MSFIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAFT
LREAQGDVPAVVMHYGVFIQNVFDFVIVAFAIFMAIKLINRLNRKKEEPAAAPAPTKEEV
LLSEIRDLLKEQNNRV