Protein Info for EX28DRAFT_0035 in Enterobacter asburiae PDN3

Annotation: Zn(II)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 141 TIGR02043: Zn(II)-responsive transcriptional regulator" amino acids 1 to 131 (131 residues), 213.6 bits, see alignment E=4.5e-68 PF13411: MerR_1" amino acids 2 to 69 (68 residues), 78 bits, see alignment E=7.3e-26 PF00376: MerR" amino acids 3 to 40 (38 residues), 53.2 bits, see alignment E=3.2e-18 PF09278: MerR-DNA-bind" amino acids 45 to 110 (66 residues), 74.8 bits, see alignment E=9.9e-25

Best Hits

Swiss-Prot: 86% identical to ZNTR_ECOLI: HTH-type transcriptional regulator ZntR (zntR) from Escherichia coli (strain K12)

KEGG orthology group: K13638, MerR family transcriptional regulator, Zn(II)-responsive regulator of zntA (inferred from 98% identity to enc:ECL_04669)

Predicted SEED Role

"transcriptional regulator, MerR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (141 amino acids)

>EX28DRAFT_0035 Zn(II)-responsive transcriptional regulator (Enterobacter asburiae PDN3)
MYRIGELAKLANVTPDTIRYYEKQQMIDHEVRTEGGFRLYTDNDLQRLRFIRYARQLGFT
LDSIRELLSIRIDPEHHTCQESKSIVQARLDEVEARIQELQTMQRSLQRLNDACCGTAHS
SLYCSILEALEQGASGETQGC