Protein Info for EX28DRAFT_0015 in Enterobacter asburiae PDN3

Annotation: 30S ribosomal protein S17

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 84 TIGR03635: ribosomal protein uS17" amino acids 6 to 76 (71 residues), 128.3 bits, see alignment E=4.3e-42 PF00366: Ribosomal_S17" amino acids 10 to 76 (67 residues), 119.3 bits, see alignment E=3e-39

Best Hits

Swiss-Prot: 98% identical to RS17_KLEP7: 30S ribosomal protein S17 (rpsQ) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K02961, small subunit ribosomal protein S17 (inferred from 98% identity to eco:b3311)

MetaCyc: 98% identical to 30S ribosomal subunit protein S17 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"SSU ribosomal protein S17p (S11e)" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (84 amino acids)

>EX28DRAFT_0015 30S ribosomal protein S17 (Enterobacter asburiae PDN3)
MTDKIRTLQGRVVSDKMEKSIVVAIERIVKHPIYGKFIKRTTKLHVHDENNECGIGDKVE
IRECRPLSKTKSWTLVRVVEKAVL