Protein Info for EX28DRAFT_0006 in Enterobacter asburiae PDN3

Annotation: 50S ribosomal protein L3, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03625: 50S ribosomal protein uL3
  • amino acids 3 to 204 (202 residues), 305.2 bits, E=1.1e-95
• PF00297: Ribosomal_L3
  • amino acids 46 to 182 (137 residues), 48.3 bits, E=3.8e-17

Best Hits

Swiss-Prot: 99% identical to RL3_SHIFL: 50S ribosomal protein L3 (rplC) from Shigella flexneri

KEGG orthology group: K02906, large subunit ribosomal protein L3 (inferred from 99% identity to eco:b3320)

MetaCyc: 99% identical to 50S ribosomal subunit protein L3 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L3p (L3e)" in subsystem Ribosome LSU bacterial

Protein Sequence (209 amino acids)

>EX28DRAFT_0006 50S ribosomal protein L3, bacterial (Enterobacter asburiae PDN3)
MIGLVGKKVGMTRIFTEDGVSIPVTVIEVEANRVTQVKDLANDGYRAVQVTTGAKKANRV
TKPEAGHFAKAGVEAGRGLWEFRLAEGEEFTVGQDISVELFADVKKVDVTGTSKGKGFAG
TVKRWNFRTQDATHGNSLSHRVPGSIGQNQTPGKVFKGKKMAGQLGNERVTVQSLDVVRV
DAERNLLLVKGAVPGATGSDLIVKPAVKA