Protein Info for EFB2_04848 in Escherichia fergusonii Becca

Annotation: dTDP-4-amino-4,6-dideoxygalactose transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 TIGR02379: TDP-4-keto-6-deoxy-D-glucose transaminase" amino acids 1 to 376 (376 residues), 736.1 bits, see alignment E=3.5e-226 PF01041: DegT_DnrJ_EryC1" amino acids 13 to 371 (359 residues), 293.1 bits, see alignment E=5.4e-91 PF00155: Aminotran_1_2" amino acids 44 to 155 (112 residues), 41.7 bits, see alignment E=1.3e-14 PF00266: Aminotran_5" amino acids 47 to 160 (114 residues), 34.5 bits, see alignment E=1.8e-12

Best Hits

Swiss-Prot: 98% identical to WECE_ECOLI: dTDP-4-amino-4,6-dideoxygalactose transaminase (wecE) from Escherichia coli (strain K12)

KEGG orthology group: K02805, lipopolysaccharide biosynthesis protein (inferred from 98% identity to eco:b3791)

MetaCyc: 98% identical to dTDP-4-dehydro-6-deoxy-D-glucose transaminase (Escherichia coli K-12 substr. MG1655)
dTDP-4-amino-4,6-dideoxygalactose transaminase. [EC: 2.6.1.59]

Predicted SEED Role

"Lipopolysaccharide biosynthesis protein RffA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.59

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (376 amino acids)

>EFB2_04848 dTDP-4-amino-4,6-dideoxygalactose transaminase (Escherichia fergusonii Becca)
MIPFNAPPVVGTELDYMQSAMGSGKLCGDGGFTRRCQQWLEQRFGSAKVLLTPSCTASLE
MAALLLDIQPGDEVIMPSYTFVSTANAFVLRGAKIVFVDVRPDTMNIDETLIEAAITDKT
RVIVPVHYAGVACEMDTIMALAKKHNLFVVEDAAQGVMSTYKGRALGTIGHIGCFSFHET
KNYTAGGEGGATLINDKALIERAEIIREKGTNRSQFFRGQVDKYTWRDIGSSYLMSDLQA
AYLWAQLEAAERINQQRLALWQNYYDALAPLAEAGRIELPSIPDDCVQNAHMFYIKLRDI
DDRSALISFLKEAEIMAVFHYIPLHASPAGERFGEFHGEDRYTTKESERLLRLPLFYNLS
PVNQRTVIATLLNYFS