Protein Info for EFB2_04723 in Escherichia fergusonii Becca

Annotation: Formate dehydrogenase-O iron-sulfur subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 259 to 278 (20 residues), see Phobius details TIGR01582: formate dehydrogenase, beta subunit" amino acids 7 to 289 (283 residues), 478.5 bits, see alignment E=2.9e-148 PF12838: Fer4_7" amino acids 38 to 114 (77 residues), 30.1 bits, see alignment E=2.8e-10 PF13247: Fer4_11" amino acids 92 to 188 (97 residues), 86.4 bits, see alignment E=6.3e-28 PF13237: Fer4_10" amino acids 94 to 144 (51 residues), 31.1 bits, see alignment 9.5e-11 PF00037: Fer4" amino acids 130 to 147 (18 residues), 22 bits, see alignment (E = 5.7e-08) PF09163: Form-deh_trans" amino acids 246 to 288 (43 residues), 70.7 bits, see alignment 3.5e-23

Best Hits

Swiss-Prot: 100% identical to FDOH_SHIFL: Formate dehydrogenase-O iron-sulfur subunit (fdoH) from Shigella flexneri

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 100% identity to eco:b3893)

MetaCyc: 100% identical to formate dehydrogenase O subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>EFB2_04723 Formate dehydrogenase-O iron-sulfur subunit (Escherichia fergusonii Becca)
MAYQSQDIIRRSATNGLTPAPQARDFQEEVAKLIDVTTCIGCKACQVACSEWNDIRDTVG
NNIGVYDNPNDLSAKSWTVMRFSEVEQNDKLEWLIRKDGCMHCSDPGCLKACPAEGAIIQ
YANGIVDFQSEQCIGCGYCIAGCPFDIPRLNPEDNRVYKCTLCVDRVVVGQEPACVKTCP
TGAIHFGTKESMKTLASERVAELKTRGYDNAGLYDPAGVGGTHVMYVLHHADKPNLYHGL
PENPEISETVKFWKGIWKPLAAVGFAATFAASIFHYVGVGPNRADEEENNLHEEKDEERK