Protein Info for EFB2_04622 in Escherichia fergusonii Becca

Annotation: 2-iminoacetate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 TIGR02351: thiazole biosynthesis protein ThiH" amino acids 3 to 368 (366 residues), 530.5 bits, see alignment E=9.8e-164 PF04055: Radical_SAM" amino acids 81 to 233 (153 residues), 52.4 bits, see alignment E=7.3e-18 PF06968: BATS" amino acids 258 to 360 (103 residues), 48.2 bits, see alignment E=9.9e-17

Best Hits

Swiss-Prot: 98% identical to THIH_ECOLI: 2-iminoacetate synthase (thiH) from Escherichia coli (strain K12)

KEGG orthology group: K03150, thiamine biosynthesis ThiH (inferred from 98% identity to eco:b3990)

MetaCyc: 98% identical to 2-iminoacetate synthase (Escherichia coli K-12 substr. MG1655)
RXN-11319 [EC: 4.1.99.19]

Predicted SEED Role

"2-iminoacetate synthase (ThiH) (EC 4.1.99.19)" (EC 4.1.99.19)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>EFB2_04622 2-iminoacetate synthase (Escherichia fergusonii Becca)
MKTFSDRWRQLDWDDIRLRINGKTAADVERALNASQLTRDDMMALLSPAASGYLEPLAQR
AQRLTRQRFGNVVSFYVPLYLSNLCANDCTYCGFSMSNRIKRKTLDEADIAKESAAIREM
GFEHLLLVTGEHQAKVGMDYFRRHLPALREQFSSLQMEVQPLAEAEYAELKQLGLDGVMV
YQETYHEATYAHHHLKGKKQDFFWRLETPDRLGRAGIDKIGLGALIGLSDSWRVDCYMVA
EHLLWLQQHYWQSRYSVSFPRLRPCTGGIEPASIMDERQLVQAICAFRLLAPEIELSLST
RESPWFRDRVIPLAINNVSAFSKTQPGGYADNHPELEQFSPHDDRRPEAVAAALTAQGLQ
PVWKDWDSYLGRPSQRP