Protein Info for EFB2_04569 in Escherichia fergusonii Becca

Annotation: Maltose/maltodextrin transport system permease protein MalF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 278 to 306 (29 residues), see Phobius details amino acids 316 to 340 (25 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details amino acids 485 to 506 (22 residues), see Phobius details PF20872: MalF_N_TM" amino acids 14 to 61 (48 residues), 79.2 bits, see alignment 2.2e-26 PF14785: MalF_P2" amino acids 100 to 260 (161 residues), 203.9 bits, see alignment E=2.5e-64 PF00528: BPD_transp_1" amino acids 298 to 501 (204 residues), 78.8 bits, see alignment E=7e-26

Best Hits

Swiss-Prot: 99% identical to MALF_ECOLI: Maltose/maltodextrin transport system permease protein MalF (malF) from Escherichia coli (strain K12)

KEGG orthology group: K10109, maltose/maltodextrin transport system permease protein (inferred from 99% identity to eco:b4033)

MetaCyc: 99% identical to maltose ABC transporter membrane subunit MalF (Escherichia coli K-12 substr. MG1655)
ABC-16-RXN [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]; 7.5.2.1 [EC: 7.5.2.1]

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>EFB2_04569 Maltose/maltodextrin transport system permease protein MalF (Escherichia fergusonii Becca)
MDVIKKKHWWQSDALKWSVLGLLGLLVGYLVVLMYAQGEYLFAITTLILSSAGLYIFANR
KAYAWRYVYPGMAGMGLFVLFPLVCTIAIAFTNYSSTNQLTFERAQEVLLDRSWQAGKIY
NFGLYPAGDEWQLALSDGETGKNYLSDAFKFGGEQKLQLKETTAQPEGERANLRVITQNR
QALSDLTAILPDGNKVMMSSLRQFSGTQPLYTLDGDGTLTNNQSGVKYRPNNQIGFYQSI
TADGNWGDEKLSPGYTVTTGWKNFTRVFTDEGIQKPFLAIFVWTVVFSLITVFLTVAVGM
VLACLVQWEALRGKAVYRVLLILPYAVPSFISILIFKGLFNQSFGEINMMLSALFGVKPA
WFSDPTTTRTMLIIVNTWLGYPYMMILCMGLLKAIPDDLYEASAMDGAGPFQNFFKITLP
LLIKPLTPLMIASFAFNFNNFVLIQLLTNGGPDRLGTTTPAGYTDLLVNYTYRIAFEGGG
GQDFGLAAAIATLIFLLVGALAIVNLKATRMKFD