Protein Info for EFB2_04547 in Escherichia fergusonii Becca

Annotation: Alanine racemase, biosynthetic

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 TIGR00492: alanine racemase" amino acids 3 to 359 (357 residues), 501.7 bits, see alignment E=5.5e-155 PF01168: Ala_racemase_N" amino acids 8 to 219 (212 residues), 238.7 bits, see alignment E=6.3e-75 PF00842: Ala_racemase_C" amino acids 234 to 357 (124 residues), 137 bits, see alignment E=2.8e-44

Best Hits

Swiss-Prot: 100% identical to ALR1_SHIBO: Alanine racemase, biosynthetic (alr) from Shigella boydii

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 100% identity to eco:b4053)

MetaCyc: 100% identical to alanine racemase 1 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.1.1

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>EFB2_04547 Alanine racemase, biosynthetic (Escherichia fergusonii Becca)
MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGHGLLETARTLPDADAFGVARL
EEALRLRAGGITKPVLLLEGFFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW
MKLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHFARADEPKCGATEKQLAIFNT
FCEGKPGQRSIAASGGILLWPQSHFDWVRPGIILYGVSPLEDRSTGADFGCQPVMSLTSS
LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPRAAPSGTPVLVNGREVPIVGR
VAMDMICVDLGPQAQDKAGDPVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD