Protein Info for EFB2_04544 in Escherichia fergusonii Becca

Annotation: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex" amino acids 2 to 383 (382 residues), 519.7 bits, see alignment E=3.3e-160 PF00364: Biotin_lipoyl" amino acids 3 to 75 (73 residues), 65.8 bits, see alignment E=5e-22 PF02817: E3_binding" amino acids 92 to 126 (35 residues), 44.5 bits, see alignment 2.9e-15 PF00198: 2-oxoacid_dh" amino acids 154 to 382 (229 residues), 281.3 bits, see alignment E=1.2e-87

Best Hits

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 98% identity to ecp:ECP_4275)

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.61

Use Curated BLAST to search for 2.3.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>EFB2_04544 Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (Escherichia fergusonii Becca)
MIEITVPVLPESVTEGTLTTWCKQEGEHVKRDDVIAELETDKVILEIPAPHDGVLSNIIV
SEGSTVTSAQLLAHLKPQAVIEETVTPVTETLAMPSARLEAQRSGVELADVAGSGRNGRI
LKEDVQRVTPAPATQPERVAEIAPAKPLTPGARHERREPMSRLRQRIAERLLASQQNNAI
LTTFNEVNMQSVMDLRTRWKDRFAEKHGVKLGFMSFFVKAVTRALERFPVVNASVDGNEI
IWRDYCDIGIAVSSNRGLVVPVLRNAQSLSLGEIERQIAEYATQARNGKLPLEALQGGTF
SITNGGTFGSMMSTPIINPPQSAILGMHAITPRPVAENGQVVIRPMMYLALSYDHRIIDG
QEAVQTLVAIRELLESPEQLLLDL