Protein Info for EFB2_04494 in Escherichia fergusonii Becca

Annotation: D-allose-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13407: Peripla_BP_4" amino acids 28 to 288 (261 residues), 203.5 bits, see alignment E=7e-64 PF00532: Peripla_BP_1" amino acids 29 to 243 (215 residues), 68.6 bits, see alignment E=9.8e-23 PF13377: Peripla_BP_3" amino acids 161 to 286 (126 residues), 34.6 bits, see alignment E=3e-12

Best Hits

Swiss-Prot: 100% identical to ALSB_ECOLI: D-allose-binding periplasmic protein (alsB) from Escherichia coli (strain K12)

KEGG orthology group: K10549, D-allose transport system substrate-binding protein (inferred from 100% identity to eco:b4088)

MetaCyc: 100% identical to D-allose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-42-RXN [EC: 7.5.2.8]

Predicted SEED Role

"D-allose ABC transporter, substrate-binding component" in subsystem D-allose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>EFB2_04494 D-allose-binding periplasmic protein (Escherichia fergusonii Becca)
MNKYLKYFSGTLVGLMLSTSAFAAAEYAVVLKTLSNPFWVDMKKGIEDEAKTLGVSVDIF
ASPSEGDFQSQLQLFEDLSNKNYKGIAFAPLSSVNLVMPVARAWKKGIYLVNLDEKIDMD
NLKKAGGNVEGFVTTDNVAVGAKGASFIIDKLGAEGGEVAIIEGKAGNASGEARRNGATE
AFKKASQIKLVASQPADWDRIKALDVATNVLQRNPNIKAIYCANDTMAMGVAQAVANAGK
TGKVLVVGTDGIPEARKMVEAGQMTATVAQNPADIGATGLKLMVDAEKSGKVIPLDKAPE
FKLVDSILVTQ