Protein Info for EFB2_04375 in Escherichia fergusonii Becca

Annotation: Phosphatidylserine decarboxylase proenzyme

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 TIGR00163: phosphatidylserine decarboxylase" amino acids 49 to 286 (238 residues), 339 bits, see alignment E=6.1e-106 PF02666: PS_Dcarbxylase" amino acids 63 to 281 (219 residues), 211.7 bits, see alignment E=4.2e-67

Best Hits

Swiss-Prot: 100% identical to PSD_ECOUT: Phosphatidylserine decarboxylase proenzyme (psd) from Escherichia coli (strain UTI89 / UPEC)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 100% identity to eco:b4160)

MetaCyc: 100% identical to phosphatidylserine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>EFB2_04375 Phosphatidylserine decarboxylase proenzyme (Escherichia fergusonii Becca)
MLNSFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKYYKVDMKEAQKPDTASY
RTFNEFFVRPLRDEVRPIDTDPNVLVMPADGVISQLGKIEEDKILQAKGHNYSLEALLAG
NYLMADLFRNGTFVTTYLSPRDYHRVHMPCNGILREMIYVPGDLFSVNHLTAQNVPNLFA
RNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTITPPREGIIKRWTWPAGENDDSVA
LLKGQEMGRFKLGSTVINLFAPGKVNLVEQLESLSVTKIGQPLAVSTETFVTPDAEPAPL
PAEEIEAEHDASPLVDDKKDQV