Protein Info for EFB2_04337 in Escherichia fergusonii Becca

Annotation: L-ribulose-5-phosphate 4-epimerase UlaF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 100% identical to ULAF_ECOL5: L-ribulose-5-phosphate 4-epimerase UlaF (ulaF) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K03077, L-ribulose-5-phosphate 4-epimerase [EC: 5.1.3.4] (inferred from 97% identity to ect:ECIAI39_4663)

MetaCyc: 98% identical to L-ribulose-5-phosphate 4-epimerase UlaF (Escherichia coli K-12 substr. MG1655)
L-ribulose-5-phosphate 4-epimerase. [EC: 5.1.3.4]

Predicted SEED Role

"L-ribulose-5-phosphate 4-epimerase UlaF (EC 5.1.3.4) (L-ascorbate utilization protein F)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 5.1.3.4)

MetaCyc Pathways

L-ascorbate degradation II (bacterial, aerobic) (7/7 steps found)
L-ascorbate degradation I (bacterial, anaerobic) (5/5 steps found)
L-arabinose degradation I (4/4 steps found)
L-lyxose degradation (4/4 steps found)
superpathway of pentose and pentitol degradation (18/42 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.4

Use Curated BLAST to search for 5.1.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>EFB2_04337 L-ribulose-5-phosphate 4-epimerase UlaF (Escherichia fergusonii Becca)
MQKLKQQVFEANMDLPHYGLVTFTWGNVSAIDRERGLVVIKPSGVAYETMKADDMVVVDM
SGKVVEGEYRPSSDTATHLELYRRYPSLGGIVHTHSTHATAWAQAGLAIPALGTTHADYF
FGDIPCTRGLSEEEVQGEYELNTGKVIIETLGDAEPLHTPGIVVYQHGPFAWGKDAHDAV
HNAVVMEEVAKMAWIARSINPQLNHIDSFLMNKHFMRKHGPNAYYGQK