Protein Info for EFB2_04257 in Escherichia fergusonii Becca

Annotation: Fimbrial adhesin PapG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF03627: PapG_N" amino acids 1 to 225 (225 residues), 374.6 bits, see alignment E=1.9e-116 PF03628: PapG_C" amino acids 227 to 335 (109 residues), 193.9 bits, see alignment E=4.5e-62

Best Hits

Swiss-Prot: 98% identical to PRSG_ECOLX: Fimbrial protein PrsG (prsG) from Escherichia coli

KEGG orthology group: K12522, adhesin PapG (inferred from 100% identity to eci:UTI89_C4887)

Predicted SEED Role

"PapG protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>EFB2_04257 Fimbrial adhesin PapG (Escherichia fergusonii Becca)
MKKWLPAFLFLSLSGCNDALAANQSTMFYSFNDNIYRPQLSVKVTDIVQFIVDINSASST
ATLSYVACNGFTWTHGLYWSEYFAWLVVPKHVSYNGYNIYLELQSRGSFSLDAEDNDNYY
LTKGFAWDEVNSSGRVCFDIGEKRSLAWSFGGVTLNARLPVDLPKGDYTFPVKFLRGIQR
NNYDYIGGRYKIPSSLMKTFPFNGTLNFSIKNTGGCRPSAQSLEINHGDLSINSANNHYA
AQTLSVSCDVPTNIRFFLLSNTTPAYSHGQQFSVGLGHGWDSIVSINGVDTGETTMRWYR
AGTQNLTIGSRLYGESSKIQPGVLSGSATLLMILP