Protein Info for EFB2_04236 in Escherichia fergusonii Becca

Annotation: Inner membrane protein YphA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 43 to 67 (25 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 105 to 125 (21 residues), see Phobius details PF07291: MauE" amino acids 6 to 86 (81 residues), 28.5 bits, see alignment E=2.6e-10 PF07681: DoxX" amino acids 8 to 90 (83 residues), 68.3 bits, see alignment E=1.1e-22 PF02077: SURF4" amino acids 51 to 131 (81 residues), 42 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 45% identical to YPHA_SHIFL: Inner membrane protein YphA (yphA) from Shigella flexneri

KEGG orthology group: None (inferred from 99% identity to ecp:ECP_3787)

Predicted SEED Role

"FIG00639582: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (132 amino acids)

>EFB2_04236 Inner membrane protein YphA (Escherichia fergusonii Becca)
MGNYTSALLLLARLMLACLYMISGVPKLLSFTGTIDKMASLGLIFPAITAAIVVLVEIVG
ALMIVFGFFTRPVSIILCLYTVLASFLGHAFWTMPAELAHGNMIHFYKNICISGGFLALV
VSGPGRISVDRR