Protein Info for EFB2_04104 in Escherichia fergusonii Becca

Annotation: Toxic protein SymE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 PF08845: SymE_toxin" amino acids 20 to 71 (52 residues), 76.4 bits, see alignment E=7.5e-26

Best Hits

Swiss-Prot: 96% identical to SYME_ECO27: Endoribonuclease SymE (symE) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: None (inferred from 94% identity to eco:b4347)

Predicted SEED Role

"FIG00638399: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (112 amino acids)

>EFB2_04104 Toxic protein SymE (Escherichia fergusonii Becca)
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYNRIPAITLKGQWLEAAGFATGTAVDV
KVMEGCIVLTAQPPAAEESELMQSLRQVCKLSARKQKQVQDFIGVISNKTPR