Protein Info for EFB2_03967 in Escherichia fergusonii Becca

Annotation: Catabolite repressor/activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 TIGR02417: D-fructose-responsive transcription factor" amino acids 2 to 328 (327 residues), 518 bits, see alignment E=5.3e-160 PF00356: LacI" amino acids 3 to 50 (48 residues), 64.9 bits, see alignment 9.4e-22 PF00532: Peripla_BP_1" amino acids 62 to 312 (251 residues), 52.7 bits, see alignment E=9.4e-18 PF13407: Peripla_BP_4" amino acids 64 to 283 (220 residues), 38.9 bits, see alignment E=1.5e-13 PF13377: Peripla_BP_3" amino acids 180 to 328 (149 residues), 39.9 bits, see alignment E=9.6e-14

Best Hits

Swiss-Prot: 100% identical to CRA_ECOL6: Catabolite repressor/activator (cra) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03435, LacI family transcriptional regulator, fructose operon transcriptional repressor (inferred from 100% identity to eco:b0080)

Predicted SEED Role

"Fructose repressor FruR, LacI family" in subsystem Fructose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>EFB2_03967 Catabolite repressor/activator (Escherichia fergusonii Becca)
MKLDEIARLAGVSRTTASYVINGKAKQYRVSDKTVEKVMAVVREHNYHPNAVAAGLRAGR
TRSIGLVIPDLENTSYTRIANYLERQARQRGYQLLIACSEDQPDNEMRCIEHLLQRQVDA
IIVSTSLPPEHPFYQRWANDPFPIVALDRALDREHFTSVVGADQDDAEMLAEELRKFPAE
TVLYLGALPELSVSFLREQGFRTAWKDDPREVHFLYANSYEREAAAQLFEKWLETHPMPQ
ALFTTSFALLQGVMDVTLRRDGKLPSDLAIATFGDNELLDFLQCPVLAVAQRHRDVAERV
LEIVLASLDEPRKPKPGLTRIKRNLYRRGVLSRS