Protein Info for EFB2_03950 in Escherichia fergusonii Becca

Annotation: Secretion monitor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 40 to 60 (21 residues), see Phobius details PF06558: SecM" amino acids 49 to 193 (145 residues), 197.8 bits, see alignment E=4.4e-63

Best Hits

Swiss-Prot: 99% identical to SECM_ECO57: Secretion monitor (secM) from Escherichia coli O157:H7

KEGG orthology group: K13301, secretion monitor (inferred from 97% identity to sbc:SbBS512_E0091)

Predicted SEED Role

"Secretion monitor precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (195 amino acids)

>EFB2_03950 Secretion monitor (Escherichia fergusonii Becca)
MLWTSGFNDKICALNTFEYDRDGNNVSGILTRWRQFGKRYFWPHLLLGMVAASLGLPALS
NAAEPNAPAKATTRNHEPSAKVNFGQLALLEANTRRPNSNYSVDYWHQHAIRTVIRHLSF
AMAPQTLPVAEESLPLQAQHLALLDTLSALLTQEGTPSEKGYRIDYAHFTPQAKFSTPVW
ISQAQGIRAGPQRLS