Protein Info for EFB2_03937 in Escherichia fergusonii Becca

Annotation: Aromatic amino acid transport protein AroP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 transmembrane" amino acids 21 to 40 (20 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 85 to 106 (22 residues), see Phobius details amino acids 124 to 142 (19 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details amino acids 240 to 262 (23 residues), see Phobius details amino acids 282 to 302 (21 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details amino acids 427 to 445 (19 residues), see Phobius details PF00324: AA_permease" amino acids 18 to 454 (437 residues), 477.8 bits, see alignment E=3.7e-147 PF13520: AA_permease_2" amino acids 22 to 438 (417 residues), 126.3 bits, see alignment E=1.6e-40

Best Hits

Swiss-Prot: 100% identical to AROP_ECOL6: Aromatic amino acid transport protein AroP (aroP) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K11734, aromatic amino acid transport protein AroP (inferred from 99% identity to eco:b0112)

MetaCyc: 99% identical to aromatic amino acid:H+ symporter AroP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-56; TRANS-RXN-76; TRANS-RXN-77

Predicted SEED Role

"Aromatic amino acid transport protein AroP" in subsystem Aromatic amino acid degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (456 amino acids)

>EFB2_03937 Aromatic amino acid transport protein AroP (Escherichia fergusonii Becca)
MEGQQHGEQLKRGLKNRHIQLIALGGAIGTGLFLGSASVIQSAGPGIILGYAIAGFIAFL
IMRQLGEMVVEEPVAGSFSHFAYKYWGSFACFASGWNYWVLYVLVAMAELTAVGKYIQFW
YPEIPTWVSAAVFFVVINAINLTNVKVFGEMEFWFAIIKVIAVVAMIIFGAWLLFSGNGG
PQASVSNLWDQGGFLPHGFTGLVMMMAIIMFSFGGLELVGITAAEADNPEQSIPKATNQV
IYRILIFYIGSLAVLLSLMPWTRVTADTSPFVLIFHELGDTFVANALNIVVLTAALSVYN
SCVYCNSRMLFGLAQQGNAPKALASVDKRGVPVNTILVSALVTALCVLINYLAPESAFGL
LMALVVSALVINWAMISLAHMKFRRAKQEQGVVTRFPALLYPLGNWICLLFMAAVLVIML
MTPGMAISVYLIPVWLIVLGIGYLFKEKTAKAVKAH