Protein Info for EFB2_03807 in Escherichia fergusonii Becca

Annotation: Actin cross-linking toxin VgrG1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 TIGR03361: type VI secretion system Vgr family protein" amino acids 8 to 519 (512 residues), 600.3 bits, see alignment E=2.9e-184 TIGR01646: Rhs element Vgr protein" amino acids 21 to 501 (481 residues), 425.3 bits, see alignment E=3.6e-131 PF05954: Phage_GPD" amino acids 34 to 327 (294 residues), 253.2 bits, see alignment E=6.8e-79 PF04717: Phage_base_V" amino acids 385 to 451 (67 residues), 53.6 bits, see alignment E=4.8e-18 PF22178: Gp5_trimer_C" amino acids 468 to 542 (75 residues), 77.6 bits, see alignment E=1.6e-25 amino acids 545 to 603 (59 residues), 32.3 bits, see alignment 1.9e-11 PF06715: Gp5_C" amino acids 501 to 523 (23 residues), 21.9 bits, see alignment (E = 2.8e-08)

Best Hits

KEGG orthology group: K11904, type VI secretion system secreted protein VgrG (inferred from 99% identity to ecp:ECP_0240)

Predicted SEED Role

"VgrG-3 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (660 amino acids)

>EFB2_03807 Actin cross-linking toxin VgrG1 (Escherichia fergusonii Becca)
MSLKGLRFTLEVDGQEPDTFAVVNFRLIQNQSYPFVMSVDVASDSFMQTAEMLLEKKATL
TIWQGVIPQRYVTGVVAGFGMPENNGWQMRYHLRIEPPLWRCGLRQNFRIFQQQDIRTIS
ATLLNENGVTEWTPLFYEDHPAREFCVQYGESDLAFLARLWAEEGIFFFERFAADSPEQK
LTLCDDVAGLSQAGEFPFNPDASTGAETECVSMFRYEAHVRPSSVQSQDYTFKVPDWPGM
YEQQGESLNGQLEQYEIFDYPGRYKDEQHGKDFTLYRMESLRSDAEKATGQSNSPKLWPG
TRFTLTGHPQKMLNREWQVVQSILSGDQPQALHGSQGRGTTLGNQLEVIPADRTWRPRQQ
SKPKVDGPQSAIVTGPAGEEIFCDEHGRVRVKFHWDRYNSATEASSCWVRVSQAWAGPGF
GNLAIPRVGQEVIVDFLNGDPDQPIIMGRTYHEDNRSPGSLPGTKTQMTIRSKTYKGSGF
NELRFEDATGGEQVYIHAQKNMDTEVLNNRTTDVKADHTETIGNDQKITVGLGQTVNVGS
KKEGGHDQKVTVANDQHLTIKNDRHKVVNNNQTSKVTGTDTEEVVKKQSIKIGDNYELKV
EHGTNIISGDSIELICGQGESGTCSIKLEKTGKIIIRGTEFLFEATGPVDIKGKDIHLNG