Protein Info for EFB2_03785 in Escherichia fergusonii Becca

Annotation: RNA-splicing ligase RtcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 TIGR03073: release factor H-coupled RctB family protein" amino acids 12 to 367 (356 residues), 618.5 bits, see alignment E=1.7e-190 PF01139: RtcB" amino acids 29 to 95 (67 residues), 47.3 bits, see alignment E=9.1e-17 amino acids 100 to 372 (273 residues), 200.4 bits, see alignment E=3.1e-63

Best Hits

KEGG orthology group: None (inferred from 99% identity to ecq:ECED1_0269)

Predicted SEED Role

"Protein with similarity to RtcB" in subsystem RNA 3'-terminal phosphate cyclase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>EFB2_03785 RNA-splicing ligase RtcB (Escherichia fergusonii Becca)
MGKYIRPLSDAVFTIASDDLWIESLAIQQLHTTANLPNMQRVVGMPDLHPGRGYPIGAAL
FSVGRFYPALVGNDIGCGMALWQTDILARKYNADKFEKRLSDLDDVAEESWLEENLPSAF
AQHPWRNSLGSIGGGNHFAELQQIDQIIDAELFALAGLDAQHLQLLVHSGSRGLGQSILQ
RHIASFSHHGLPEGSDDALRYIAEHDDALAFARINRQLIALRIMQQVKATGSPVLDVAHN
FVSACQIGDQQGWLHRKGATPDDNGLVIIPGSRGDYSWLVKPVANEKTLHSLAHGAGRKW
GRTECKGRLAAKYTATQLSRTELGSRVICRDKQLIFEEAPQAYKSAESVVQCLVLAGLII
PVARLRPVLTLKNSGGKKG