Protein Info for EFB2_03784 in Escherichia fergusonii Becca

Annotation: Peptide chain release factor 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 TIGR03072: putative peptide chain release factor H" amino acids 2 to 201 (200 residues), 328.7 bits, see alignment E=5.4e-103 PF00472: RF-1" amino acids 106 to 194 (89 residues), 86.2 bits, see alignment E=8e-29

Best Hits

Swiss-Prot: 99% identical to RFH_ECOLI: Putative peptide chain release factor homolog (prfH) from Escherichia coli (strain K12)

KEGG orthology group: K02839, peptide chain release factor (inferred from 98% identity to ecy:ECSE_0256)

Predicted SEED Role

"Peptide chain release factor homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>EFB2_03784 Peptide chain release factor 1 (Escherichia fergusonii Becca)
MILLQLSSAQGPEECCLAVKKALDRLIKEATRQDVAVTVLETETGRYSDTLRSALISLDG
DNAWALSESWCGTIQWICPSPYRPHHGRKNWFLGIGRFTADEQEQSDAIRYETLRSSGPG
GQHVNKTDSAVRATHLASGISVKVQSERSQHANKRLARLLIAWKLEQQQQENSAALKSQR
RMFHHQIERGNPRRTFTGMAFIEG