Protein Info for EFB2_03754 in Escherichia fergusonii Becca

Annotation: Fimbria adhesin EcpD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details

Best Hits

Swiss-Prot: 100% identical to ECPD_ECOL6: Fimbria adhesin EcpD (ecpD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to ecz:ECS88_0287)

Predicted SEED Role

"CFA/I fimbrial minor adhesin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (547 amino acids)

>EFB2_03754 Fimbria adhesin EcpD (Escherichia fergusonii Becca)
MRVNLLIAMIIFALIWPATALRAAVSKTTWADAPAREFVFVENNSDDNFFVTPGGALDPR
LTGANRWTGLKYNGSGTIYQQSLGYIDNGYNTGLYTNWKFDMWLENSPVSSPLTGLRCIN
WYAGCNMTTSLILPQTTDASGFYGATVTSGGAKWMHGMLSDAFYQYLQQMPVGSSFTMTI
NACQTSVNYDASSGARCKDQASGNWYVRNVTHTKAANLRLINTHSLAEVFINSDGVPTLG
EGNADCRTQTIGSRSGLSCKMVNYTLQTNGLSNTSIHIFPAIANSSLASAVGAYDMQFSL
NGSSWKPVSNTAYYYTFNEMKSADSIYVFFSSNFFKQMVNLGISDINTKDLFNFRFQNTT
SPESGWYEFSTSNTLIIKPRDFSISIISDEYTQTPSREGYVGSGESALDFGYIVTTSGKT
AADEVLIKVTGPAQVIGGRSYCVFSSDDGKAKVPFPATLSFITRNGATKTYDAGCDDSWR
DMTDALWLTTPWTDISGEVGQMDKTTVKFSIPMDNAISLRTVDDNGWFGEVSASGEIHVQ
ATWRNIN