Protein Info for EFB2_03391 in Escherichia fergusonii Becca

Annotation: 5-oxoprolinase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 TIGR00724: biotin-dependent carboxylase uncharacterized domain" amino acids 1 to 310 (310 residues), 480.9 bits, see alignment E=7.7e-149 PF02626: CT_A_B" amino acids 25 to 281 (257 residues), 316.5 bits, see alignment E=8.4e-99

Best Hits

Swiss-Prot: 99% identical to PXPC_ECOLI: 5-oxoprolinase subunit C (pxpC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 99% identity to eco:b0712)

MetaCyc: 99% identical to 5-oxoprolinase component C (Escherichia coli K-12 substr. MG1655)
5-oxoprolinase (ATP-hydrolyzing). [EC: 3.5.2.9]

Predicted SEED Role

"Allophanate hydrolase 2 subunit 2 (EC 3.5.1.54)" (EC 3.5.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.54

Use Curated BLAST to search for 3.5.1.54 or 3.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>EFB2_03391 5-oxoprolinase subunit C (Escherichia fergusonii Becca)
MLKIIRAGMYTTVQDGGRHGFRQSGISHCGALDMPALRIANLLVGNDANAPALEITLGQL
TVEFETDGWFALTGAGCEARLDDNAVWTGWRLPMRAGQRLTLKRPQHGMRSYLAVAGGID
VPPVMGSCSTDLKVGIGGLEGRLLRDGDRLPIGKAKRDFMEAQGVKQLLWGNRIRALPGP
EYHEFDRASQDAFWRSPWQLSSQSNRMGYRLQGQILKRTTDRELLSHGLLPGVVQVPHNG
QPIVLMNDAQTTGGYPRIACIIEADMYHLAQIPLGQPIHFVQCSLEEALKARQDQQRYFE
QLAWRLHNEN